PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0041s0180.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 661aa    MW: 74157 Da    PI: 6.8209
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0041s0180.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS360.23.1e-1102886582374
                    GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                             ++lL++cAeav+ +d++  ++lL+++++ ++p gd  qRla++f++AL++r+++++se+y++l++++ +    +  l+a +lf  ++
  SapurV1A.0041s0180.1.p 288 RTLLIHCAEAVAVSDHKTSTELLTQIRQYSTPFGDGSQRLAHCFANALESRITGTGSEVYATLAAKRVT---AACILKAGRLFISAC 371
                             679************************************************************999998...8999*********** PP

                    GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelg 173
                             P++ +s++ a q I++ +e++ r+Hii f+i +G+ Wp+L+q L++Rp+gpp lR+Tg++ p++g  s+  le +g+ La+++e+++
  SapurV1A.0041s0180.1.p 372 PFMVMSNFFAAQNIMDLAEKAARLHIIHFGILHGFPWPSLIQHLSTRPGGPPVLRVTGIEFPQTGyeSAAVLEDIGRYLASYCEKFN 458
                             ***************************************************************99999******************* PP

                    GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                             vpf++n+ +++++ed++le+L+++++E ++V++ ++ ++lldesv l+ +rd+vL+l+k+++P ++++   +  +ns+ F+ rf ea
  SapurV1A.0041s0180.1.p 459 VPFNYNA-ISQKWEDVQLEDLKIDRDEITVVSSLYRFQHLLDESVVLSCKRDAVLNLIKRINPAIFIHGIINGAYNSPFFVSRFREA 544
                             *******.7****************************************************************************** PP

                    GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                             l +y++lfd+lea+ +re+ er++ E+e++gr+i nv++ceg++r+er e++++W++r  +aG++++pl+e +++q++  ++  + +
  SapurV1A.0041s0180.1.p 545 LFHYTSLFDMLEANTAREDPERMVCEQEVFGRNILNVISCEGRDRVERPEKYKQWQARTARAGLRQLPLKEGIMQQVREQVKSSYHK 631
                             *************************************************************************************88 PP

                    GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                              + ++++ +++v+gWk+r L+++S+W+
  SapurV1A.0041s0180.1.p 632 DFLMDQDGQWMVQGWKGRILLAISCWK 658
                             8*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.474261638IPR005202Transcription factor GRAS
PfamPF035141.1E-107288658IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MNPVFEDPTA DAVLKYISQV LMEEESEDQT FIPRDLSLRA AERPFSDILF RKGSSSDGEV  60
SGPNQTINNA TTYCCNIYGC SSPMTTNNFV ASSSIGNGGS PPVNYTVPFS LKVSSPPLFP  120
QSVFQTFPRP VDSSVNVALK ERQLEVLFRG GTDETWKFHH QPNEMIVDFA NNRSVTPVMA  180
ITKKSNLYHS VSELKERQNH YRVERELEPR RNKQTSIYAE EAEQFGMFAG VHPSTGGDED  240
PVGFNLSEAS QSGPGMVSSY LKEQSRGSND GVIGRKNKVS CRELVDTRTL LIHCAEAVAV  300
SDHKTSTELL TQIRQYSTPF GDGSQRLAHC FANALESRIT GTGSEVYATL AAKRVTAACI  360
LKAGRLFISA CPFMVMSNFF AAQNIMDLAE KAARLHIIHF GILHGFPWPS LIQHLSTRPG  420
GPPVLRVTGI EFPQTGYESA AVLEDIGRYL ASYCEKFNVP FNYNAISQKW EDVQLEDLKI  480
DRDEITVVSS LYRFQHLLDE SVVLSCKRDA VLNLIKRINP AIFIHGIING AYNSPFFVSR  540
FREALFHYTS LFDMLEANTA REDPERMVCE QEVFGRNILN VISCEGRDRV ERPEKYKQWQ  600
ARTARAGLRQ LPLKEGIMQQ VREQVKSSYH KDFLMDQDGQ WMVQGWKGRI LLAISCWKSS  660
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-452916588375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2725010.0GU272501.1 Populus balsamifera isolate FRE01 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725020.0GU272502.1 Populus balsamifera isolate FRE01 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725030.0GU272503.1 Populus balsamifera isolate GAL12 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725040.0GU272504.1 Populus balsamifera isolate GAL12 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725050.0GU272505.1 Populus balsamifera isolate GIL14 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725060.0GU272506.1 Populus balsamifera isolate GIL14 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725070.0GU272507.1 Populus balsamifera isolate GPR02 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725080.0GU272508.1 Populus balsamifera isolate GPR02 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725090.0GU272509.1 Populus balsamifera isolate INU03 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725100.0GU272510.1 Populus balsamifera isolate INU03 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725110.0GU272511.1 Populus balsamifera isolate KUU07 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725120.0GU272512.1 Populus balsamifera isolate KUU07 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725130.0GU272513.1 Populus balsamifera isolate MGR10 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725140.0GU272514.1 Populus balsamifera isolate MGR10 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725150.0GU272515.1 Populus balsamifera isolate POR11 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2725160.0GU272516.1 Populus balsamifera isolate POR11 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299865.10.0hypothetical protein POPTR_0001s24870g
TrEMBLB9GJL80.0B9GJL8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s24870.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-168GRAS family protein